USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Character Bookmark
Character Bookmark Character Bookmark Character Bookmark Character Bookmark Character Bookmark Character Bookmark

Character Bookmark

$3.00 inc. tax
$3.00 ex. tax
? Tax based on California, United States.
*Orders with "Fog of War" will not ship until May 4th*

A 2x6 cardstock bookmark with tassel featuring characters from "Luna, The Lone Wolf". Coated to handle repeated use and handeling.

Select the character or characters you want below.

Buy all six for $15!
Add to an order of any novel and pay no additional shipping!
(standard shipping for paperback still applies)
Product Code: JSIB52g
weight: 2 g
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Customer Reviews

No Reviews Posted Yet - be the first!

write review
Related Products
"Luna, The Lone Wolf" P..
$11.99
"Blood of an Alpha" Pap..
$9.99
Luna's Journey Bundle
Luna's Journey Bundle
$20.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i